SCOP 1.67: Domain d1stp__: 1stp -

Lineage for d1stp__ (1stp -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.61: Streptavidin-like [50875] (6 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)

8. Domain d1stp__: 1stp - [27406]
   complexed with btn

Details for d1stp__

PDB Entry: 1stp, 2.6 Å

PDB Description: structural origins of high-affinity biotin binding to streptavidin

SCOP Domain Sequences for d1stp__:

Sequence; same for both SEQRES and ATOM records:

>d1stp__ b.61.1.1 (-) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1stp__:

• d1stp__ first appeared (with stable ids) in SCOP 1.55
  
• d1stp__ appears in SCOP 1.65
  
• d1stp__ appears in SCOP 1.69
  
• d1stp__ appears in the current release, SCOPe 2.08, called d1stpa_