SCOPe 2.06: Domain d1swpc_: 1swp C:

Lineage for d1swpc_ (1swp C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)

8. Domain d1swpc_: 1swp C: [27404]
   complexed with btn, btq; mutant

Details for d1swpc_

PDB Entry: 1swp, 2 Å

PDB Description: core-streptavidin mutant w120f in complex with biotin at ph 7.5

PDB Compounds: (C:) core-streptavidin

SCOPe Domain Sequences for d1swpc_:

Sequence; same for both SEQRES and ATOM records:

>d1swpc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanafkstlvghdtftk

Timeline for d1swpc_:

• d1swpc_ first appeared (with stable ids) in SCOP 1.55
  
• d1swpc_ appears in SCOPe 2.05
  
• d1swpc_ appears in SCOPe 2.07
  
• d1swpc_ appears in the current release, SCOPe 2.08