SCOPe 2.05: Domain d1swpb_: 1swp B:

Lineage for d1swpb_ (1swp B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)

8. Domain d1swpb_: 1swp B: [27403]
   complexed with btn, btq; mutant

Details for d1swpb_

PDB Entry: 1swp, 2 Å

PDB Description: core-streptavidin mutant w120f in complex with biotin at ph 7.5

PDB Compounds: (B:) core-streptavidin

SCOPe Domain Sequences for d1swpb_:

Sequence; same for both SEQRES and ATOM records:

>d1swpb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanafkstlvghdtftk

Timeline for d1swpb_:

• d1swpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1swpb_ appears in SCOPe 2.04
  
• d1swpb_ appears in SCOPe 2.06
  
• d1swpb_ appears in the current release, SCOPe 2.08