Lineage for d1swpa_ (1swp A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552700Protein Streptavidin [50878] (1 species)
  7. 1552701Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)
  8. 1552968Domain d1swpa_: 1swp A: [27402]
    complexed with btn, btq; mutant

Details for d1swpa_

PDB Entry: 1swp (more details), 2 Å

PDB Description: core-streptavidin mutant w120f in complex with biotin at ph 7.5
PDB Compounds: (A:) core-streptavidin

SCOPe Domain Sequences for d1swpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swpa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanafkstlvghdtftk

SCOPe Domain Coordinates for d1swpa_:

Click to download the PDB-style file with coordinates for d1swpa_.
(The format of our PDB-style files is described here.)

Timeline for d1swpa_: