Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4y9yp_: 4y9y P: [274017] Other proteins in same PDB: d4y9ya_, d4y9ye_, d4y9yg_, d4y9yi_, d4y9yj_, d4y9yk_, d4y9yl_, d4y9yn_, d4y9yo_, d4y9ys_, d4y9yu_, d4y9yw_, d4y9yx_, d4y9yy_, d4y9yz_ automated match to d1rypc_ complexed with mes, mg; mutant |
PDB Entry: 4y9y (more details), 2.8 Å
SCOPe Domain Sequences for d4y9yp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y9yp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4y9yp_: