Lineage for d4y9yr_ (4y9y R:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936887Domain d4y9yr_: 4y9y R: [274014]
    Other proteins in same PDB: d4y9ya_, d4y9ye_, d4y9yg_, d4y9yi_, d4y9yj_, d4y9yk_, d4y9yl_, d4y9yn_, d4y9yo_, d4y9ys_, d4y9yu_, d4y9yw_, d4y9yx_, d4y9yy_, d4y9yz_
    automated match to d1rype_
    complexed with mes, mg; mutant

Details for d4y9yr_

PDB Entry: 4y9y (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-h116e mutant
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d4y9yr_:

Sequence, based on SEQRES records: (download)

>d4y9yr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d4y9yr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d4y9yr_:

Click to download the PDB-style file with coordinates for d4y9yr_.
(The format of our PDB-style files is described here.)

Timeline for d4y9yr_: