Lineage for d1sldb_ (1sld B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674403Domain d1sldb_: 1sld B: [27401]
    complexed with nh2

Details for d1sldb_

PDB Entry: 1sld (more details), 2.3 Å

PDB Description: streptavidin, ph 7.5, bound to cyclic disulfide-bonded peptide ligand ac-chpqfc-nh2
PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1sldb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sldb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d1sldb_:

Click to download the PDB-style file with coordinates for d1sldb_.
(The format of our PDB-style files is described here.)

Timeline for d1sldb_: