Lineage for d1srha_ (1srh A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552700Protein Streptavidin [50878] (1 species)
  7. 1552701Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)
  8. 1552964Domain d1srha_: 1srh A: [27399]
    complexed with mob

Details for d1srha_

PDB Entry: 1srh (more details), 2.2 Å

PDB Description: structure-based design of synthetic azobenzene ligands for streptavidin
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1srha_:

Sequence, based on SEQRES records: (download)

>d1srha_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1srha_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapasgtalgwtv
awknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1srha_:

Click to download the PDB-style file with coordinates for d1srha_.
(The format of our PDB-style files is described here.)

Timeline for d1srha_: