Lineage for d4y8mp_ (4y8m P:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936874Domain d4y8mp_: 4y8m P: [273984]
    Other proteins in same PDB: d4y8ma_, d4y8me_, d4y8mg_, d4y8mi_, d4y8mj_, d4y8mk_, d4y8ml_, d4y8mn_, d4y8mo_, d4y8ms_, d4y8mu_, d4y8mw_, d4y8mx_, d4y8my_, d4y8mz_
    automated match to d1rypc_
    complexed with cl, mg; mutant

Details for d4y8mp_

PDB Entry: 4y8m (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta7-delta7_cter mutant
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4y8mp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8mp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4y8mp_:

Click to download the PDB-style file with coordinates for d4y8mp_.
(The format of our PDB-style files is described here.)

Timeline for d4y8mp_: