Lineage for d4y8mg_ (4y8m G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935185Domain d4y8mg_: 4y8m G: [273981]
    Other proteins in same PDB: d4y8ma_, d4y8mb_, d4y8mc_, d4y8md_, d4y8mf_, d4y8mh_, d4y8mi_, d4y8mj_, d4y8mk_, d4y8ml_, d4y8mm_, d4y8mn_, d4y8mo_, d4y8mp_, d4y8mq_, d4y8mr_, d4y8mt_, d4y8mv_, d4y8mw_, d4y8mx_, d4y8my_, d4y8mz_
    automated match to d1g0ug_
    complexed with cl, mg; mutant

Details for d4y8mg_

PDB Entry: 4y8m (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta7-delta7_cter mutant
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4y8mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8mg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d4y8mg_:

Click to download the PDB-style file with coordinates for d4y8mg_.
(The format of our PDB-style files is described here.)

Timeline for d4y8mg_: