SCOPe 2.07: Domain d1swnb_: 1swn B:

Lineage for d1swnb_ (1swn B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1swnb_: 1swn B: [27396]
   complexed with btn; mutant

Details for d1swnb_

PDB Entry: 1swn, 2.2 Å

PDB Description: core-streptavidin mutant w108f in complex with biotin at ph 7.0

PDB Compounds: (B:) core-streptavidin

SCOPe Domain Sequences for d1swnb_:

Sequence, based on SEQRES records:

>d1swnb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqflltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records):

>d1swnb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyenaesryvltgrydsapatdgsgtalgwtvaw
knnyrnahsattwsgqyvggaearintqflltsgtteanawkstlvghdtftkv

Timeline for d1swnb_:

• d1swnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1swnb_ appears in SCOPe 2.06
  
• d1swnb_ appears in the current release, SCOPe 2.08