SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1swnb_ (1swn B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063637Protein Streptavidin [50878] (1 species)
  7. 2063638Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 2063904Domain d1swnb_: 1swn B: [27396]
    complexed with btn; mutant

Details for d1swnb_

PDB Entry: 1swn (more details), 2.2 Å

PDB Description: core-streptavidin mutant w108f in complex with biotin at ph 7.0
PDB Compounds: (B:) core-streptavidin

SCOPe Domain Sequences for d1swnb_:

Sequence, based on SEQRES records: (download)

>d1swnb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqflltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swnb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyenaesryvltgrydsapatdgsgtalgwtvaw
knnyrnahsattwsgqyvggaearintqflltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1swnb_:

Click to download the PDB-style file with coordinates for d1swnb_.
(The format of our PDB-style files is described here.)

Timeline for d1swnb_: