Lineage for d4xvqa_ (4xvq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110238Protein cH-p21 Ras protein [52593] (1 species)
  7. 2110239Species Human (Homo sapiens) [TaxId:9606] [52594] (116 PDB entries)
    Uniprot Q6P716
  8. 2110327Domain d4xvqa_: 4xvq A: [273948]
    automated match to d4k81b_
    complexed with gnp, gol, mg

Details for d4xvqa_

PDB Entry: 4xvq (more details), 1.89 Å

PDB Description: h-ras y137e
PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d4xvqa_:

Sequence, based on SEQRES records: (download)

>d4xvqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsegipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records): (download)

>d4xvqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaa
rtvesrqaqdlarsegipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d4xvqa_:

Click to download the PDB-style file with coordinates for d4xvqa_.
(The format of our PDB-style files is described here.)

Timeline for d4xvqa_: