Lineage for d4xy2b_ (4xy2 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753715Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1753716Protein automated matches [190983] (6 species)
    not a true protein
  7. 1753717Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)
  8. 1753844Domain d4xy2b_: 4xy2 B: [273944]
    automated match to d2ourb_
    complexed with 490, mg, zn

Details for d4xy2b_

PDB Entry: 4xy2 (more details), 2.03 Å

PDB Description: crystal structure of pde10a in complex with asp9436
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4xy2b_:

Sequence, based on SEQRES records: (download)

>d4xy2b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgee

Sequence, based on observed residues (ATOM records): (download)

>d4xy2b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgee

SCOPe Domain Coordinates for d4xy2b_:

Click to download the PDB-style file with coordinates for d4xy2b_.
(The format of our PDB-style files is described here.)

Timeline for d4xy2b_:

  • d4xy2b_ appears in periodic updates to SCOPe 2.05 starting on 2015-06-17
  • d4xy2b_ is called d4xy2b1 in SCOPe 2.06
  • d4xy2b_ appears in the current release, SCOPe 2.07, called d4xy2b1