Lineage for d4xy2a1 (4xy2 A:449-770)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2015378Domain d4xy2a1: 4xy2 A:449-770 [273940]
    Other proteins in same PDB: d4xy2a2, d4xy2b2
    automated match to d2ourb_
    complexed with 490, mg, zn

Details for d4xy2a1

PDB Entry: 4xy2 (more details), 2.03 Å

PDB Description: crystal structure of pde10a in complex with asp9436
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4xy2a1:

Sequence, based on SEQRES records: (download)

>d4xy2a1 a.211.1.0 (A:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgee

Sequence, based on observed residues (ATOM records): (download)

>d4xy2a1 a.211.1.0 (A:449-770) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfg
nrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaeg
demkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnls
qwekvirgee

SCOPe Domain Coordinates for d4xy2a1:

Click to download the PDB-style file with coordinates for d4xy2a1.
(The format of our PDB-style files is described here.)

Timeline for d4xy2a1:

  • d4xy2a1 first appeared in SCOPe 2.05, called d4xy2a_

View in 3D
Domains from same chain:
(mouse over for more information)
d4xy2a2