Lineage for d1swfd_ (1swf D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674420Domain d1swfd_: 1swf D: [27394]
    circular permuted streptavidin e51/a46
    mutant

Details for d1swfd_

PDB Entry: 1swf (more details), 2 Å

PDB Description: circular permuted streptavidin e51/a46
PDB Compounds: (D:) circularly permuted core-streptavidin e51/a46

SCOP Domain Sequences for d1swfd_:

Sequence, based on SEQRES records: (download)

>d1swfd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgalt
gtyes

Sequence, based on observed residues (ATOM records): (download)

>d1swfd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvsaeagitgtwynqlgstfivtagadgaltgtyes

SCOP Domain Coordinates for d1swfd_:

Click to download the PDB-style file with coordinates for d1swfd_.
(The format of our PDB-style files is described here.)

Timeline for d1swfd_: