Lineage for d4xzrb1 (4xzr B:88-509)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726094Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256146] (2 PDB entries)
  8. 2726096Domain d4xzrb1: 4xzr B:88-509 [273939]
    Other proteins in same PDB: d4xzrb2
    automated match to d4bqka_

Details for d4xzrb1

PDB Entry: 4xzr (more details), 2.25 Å

PDB Description: structure of yeast importin a bound to the membrane protein nuclear localization signal sequence of inm protein heh1
PDB Compounds: (B:) importin subunit alpha

SCOPe Domain Sequences for d4xzrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xzrb1 a.118.1.0 (B:88-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yf

SCOPe Domain Coordinates for d4xzrb1:

Click to download the PDB-style file with coordinates for d4xzrb1.
(The format of our PDB-style files is described here.)

Timeline for d4xzrb1: