SCOPe 2.08: Domain d3wveb_: 3wve B:

Lineage for d3wveb_ (3wve B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
   also Rhodococcus sp. R312

8. Domain d3wveb_: 3wve B: [273936]
   Other proteins in same PDB: d3wvea_
   automated match to d3a8gb_
   complexed with cl, fe, mg, no, tan; mutant

Details for d3wveb_

PDB Entry: 3wve, 1.57 Å

PDB Description: crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, before photo-activation

PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d3wveb_:

Sequence; same for both SEQRES and ATOM records:

>d3wveb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevkyvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

Timeline for d3wveb_:

• d3wveb_ first appeared in SCOPe 2.05
  
• d3wveb_ appears in SCOPe 2.07