SCOPe 2.08: Domain d4w98a1: 4w98 A:1-143

Lineage for d4w98a1 (4w98 A:1-143)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:509170] [273929] (2 PDB entries)

8. Domain d4w98a1: 4w98 A:1-143 [273930]
   Other proteins in same PDB: d4w98a2
   automated match to d4uoha_

Details for d4w98a1

PDB Entry: 4w98, 1.43 Å

PDB Description: acinetobacter baumannii sdf ndk

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4w98a1:

Sequence; same for both SEQRES and ATOM records:

>d4w98a1 d.58.6.0 (A:1-143) automated matches {Acinetobacter baumannii [TaxId: 509170]}
maiertlsivkpdavsknhigeifarfekaglkivatkmkhlsqadaegfyaehkergff
gdlvafmtsgpvvvsvlegenavlahreilgatnpkeaapgtiradfavsidenaahgsd
svasaereiayffadneicprtr

Timeline for d4w98a1:

• d4w98a1 first appeared in SCOPe 2.05, called d4w98a_
  
• d4w98a1 appears in SCOPe 2.07