Lineage for d4unsb_ (4uns B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474437Protein automated matches [190087] (15 species)
    not a true protein
  7. 2474520Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 2474532Domain d4unsb_: 4uns B: [273926]
    automated match to d1w2ga_
    complexed with na, qz3

Details for d4unsb_

PDB Entry: 4uns (more details), 2.18 Å

PDB Description: mtb tmk in complex with compound 40
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4unsb_:

Sequence, based on SEQRES records: (download)

>d4unsb_ c.37.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatlap

Sequence, based on observed residues (ATOM records): (download)

>d4unsb_ c.37.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaeladaelqqrtgavyaelaaqgwggrwlvvgadvdpg
rlaatlap

SCOPe Domain Coordinates for d4unsb_:

Click to download the PDB-style file with coordinates for d4unsb_.
(The format of our PDB-style files is described here.)

Timeline for d4unsb_: