Lineage for d4unda1 (4und A:655-796)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735148Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1735149Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1735174Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1735175Protein automated matches [226964] (1 species)
    not a true protein
  7. 1735176Species Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries)
  8. 1735216Domain d4unda1: 4und A:655-796 [273923]
    Other proteins in same PDB: d4unda2, d4undb2
    automated match to d4hhyd1
    protein/DNA complex; complexed with 2yq, na

Details for d4unda1

PDB Entry: 4und (more details), 2.2 Å

PDB Description: human artd1 (parp1) - catalytic domain in complex with inhibitor talazoparib
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4unda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unda1 a.41.1.0 (A:655-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqsmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysils
evqqavsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldieva
ysllrggsddsskdpidvnyek

SCOPe Domain Coordinates for d4unda1:

Click to download the PDB-style file with coordinates for d4unda1.
(The format of our PDB-style files is described here.)

Timeline for d4unda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4unda2