![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
![]() | Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
![]() | Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
![]() | Protein automated matches [226964] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225405] (57 PDB entries) |
![]() | Domain d4undb1: 4und B:662-796 [273919] Other proteins in same PDB: d4unda2, d4unda3, d4undb2 automated match to d4hhyd1 protein/DNA complex; complexed with 2yq, na |
PDB Entry: 4und (more details), 2.2 Å
SCOPe Domain Sequences for d4undb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4undb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]} ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg sddsskdpidvnyek
Timeline for d4undb1: