Lineage for d4unnb1 (4unn B:2-210)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474437Protein automated matches [190087] (15 species)
    not a true protein
  7. 2474520Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 2474537Domain d4unnb1: 4unn B:2-210 [273918]
    Other proteins in same PDB: d4unna2, d4unnb2
    automated match to d1w2ga_
    complexed with qzz

Details for d4unnb1

PDB Entry: 4unn (more details), 2.5 Å

PDB Description: mtb tmk in complex with compound 8
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4unnb1:

Sequence, based on SEQRES records: (download)

>d4unnb1 c.37.1.1 (B:2-210) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
liaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdlas
svyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawvq
riefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavyae
laaqgwggrwlvvgadvdpgrlaatlapp

Sequence, based on observed residues (ATOM records): (download)

>d4unnb1 c.37.1.1 (B:2-210) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
liaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdlas
svyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawvq
riefarlglpkpdwqvllavsaedaelqqrtgavyaelaaqgwggrwlvvgadvdpgrla
atlapp

SCOPe Domain Coordinates for d4unnb1:

Click to download the PDB-style file with coordinates for d4unnb1.
(The format of our PDB-style files is described here.)

Timeline for d4unnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4unnb2