SCOPe 2.05: Domain d4tlfd_: 4tlf D:

Lineage for d4tlfd_ (4tlf D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
   Pfam PF05995, CDO_I

6. Protein automated matches [191276] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [189874] (2 PDB entries)

8. Domain d4tlfd_: 4tlf D: [273912]
   automated match to d3ussa_
   complexed with fe2

Details for d4tlfd_

PDB Entry: 4tlf, 2.14 Å

PDB Description: crystal structure of thiol dioxygenase from pseudomonas aeruginosa

PDB Compounds: (D:) Thiol dioxygenase

SCOPe Domain Sequences for d4tlfd_:

Sequence; same for both SEQRES and ATOM records:

>d4tlfd_ b.82.1.19 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy
llhvdsrqrfsvvsfvwgpgqitpvhdhrvwgligmlrgaeysqpyafdaggrphpsgar
rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg
ysnsrlpniwdlskenpa

Timeline for d4tlfd_:

• d4tlfd_ is new in SCOPe 2.05-stable
  
• d4tlfd_ appears in SCOPe 2.06
  
• d4tlfd_ appears in the current release, SCOPe 2.08