Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
Protein automated matches [191276] (4 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189874] (2 PDB entries) |
Domain d4tlfd_: 4tlf D: [273912] automated match to d3ussa_ complexed with fe2 |
PDB Entry: 4tlf (more details), 2.14 Å
SCOPe Domain Sequences for d4tlfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tlfd_ b.82.1.19 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} ilrldrlrqfigelatlldsrpdestllaqahpllaelvhqddwlpedcarpdpqryqqy llhvdsrqrfsvvsfvwgpgqitpvhdhrvwgligmlrgaeysqpyafdaggrphpsgar rrlepgevealsprigdvhqvsnafsdrtsisihvyganigavrravfsaegeekpfisg ysnsrlpniwdlskenpa
Timeline for d4tlfd_: