Lineage for d1swfa_ (1swf A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1800855Protein Streptavidin [50878] (1 species)
  7. 1800856Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 1801144Domain d1swfa_: 1swf A: [27391]
    circular permuted streptavidin e51/a46

Details for d1swfa_

PDB Entry: 1swf (more details), 2 Å

PDB Description: circular permuted streptavidin e51/a46
PDB Compounds: (A:) circularly permuted core-streptavidin e51/a46

SCOPe Domain Sequences for d1swfa_:

Sequence, based on SEQRES records: (download)

>d1swfa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgalt
gtyes

Sequence, based on observed residues (ATOM records): (download)

>d1swfa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
sryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwllt
sgtteanawkstlvghdtftkvsaeagitgtwynqlgstfivtagadgaltgtyes

SCOPe Domain Coordinates for d1swfa_:

Click to download the PDB-style file with coordinates for d1swfa_.
(The format of our PDB-style files is described here.)

Timeline for d1swfa_: