Lineage for d4qllb_ (4qll B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095708Species Oryza sativa [TaxId:39947] [225407] (27 PDB entries)
  8. 2095753Domain d4qllb_: 4qll B: [273903]
    automated match to d1v03a_
    complexed with ctt, mes, so4, zn; mutant

Details for d4qllb_

PDB Entry: 4qll (more details), 1.85 Å

PDB Description: crystal structure of rice bglu1 e176q/y341a/q187a mutant complexed with cellotetraose
PDB Compounds: (B:) Beta-glucosidase 7

SCOPe Domain Sequences for d4qllb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qllb_ c.1.8.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
ydagtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtavfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

SCOPe Domain Coordinates for d4qllb_:

Click to download the PDB-style file with coordinates for d4qllb_.
(The format of our PDB-style files is described here.)

Timeline for d4qllb_: