Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) duplication: tandem repeat of two OB-fold domains |
Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein) Pfam PF02760 |
Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries) Uniprot Q16666 199-301! Uniprot Q16666 302-389 |
Domain d4qgua2: 4qgu A:302-389 [273894] automated match to d2oq0a1 protein/DNA complex |
PDB Entry: 4qgu (more details), 2.54 Å
SCOPe Domain Sequences for d4qgua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qgua2 b.40.16.1 (A:302-389) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]} lkidilhkqasgnivygvfmlhkktvnqkttiyeiqddrgkmdvvgtgqchnipceegdk lqlfcfrlrkknqmsklisemhsfiqik
Timeline for d4qgua2: