SCOPe 2.08: Domain d4qgua2: 4qgu A:302-389

Lineage for d4qgua2 (4qgu A:302-389)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
   Pfam PF02760

6. Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries)
   Uniprot Q16666 199-301! Uniprot Q16666 302-389

8. Domain d4qgua2: 4qgu A:302-389 [273894]
   automated match to d2oq0a1
   protein/DNA complex

Details for d4qgua2

PDB Entry: 4qgu, 2.54 Å

PDB Description: protein domain complex with ssdna

PDB Compounds: (A:) Gamma-interferon-inducible protein 16

SCOPe Domain Sequences for d4qgua2:

Sequence; same for both SEQRES and ATOM records:

>d4qgua2 b.40.16.1 (A:302-389) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
lkidilhkqasgnivygvfmlhkktvnqkttiyeiqddrgkmdvvgtgqchnipceegdk
lqlfcfrlrkknqmsklisemhsfiqik

Timeline for d4qgua2:

• d4qgua2 first appeared in SCOPe 2.05
  
• d4qgua2 appears in SCOPe 2.07