SCOPe 2.05: Domain d2n26a_: 2n26 A:

Lineage for d2n26a_ (2n26 A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.0: automated matches [196454] (1 protein)
   not a true family

6. Protein automated matches [196455] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255137] (5 PDB entries)

8. Domain d2n26a_: 2n26 A: [273892]
   automated match to d2kmka_
   complexed with zn

Details for d2n26a_

PDB Entry: 2n26

PDB Description: solution structure of miz-1 zinc fingers 3 and 4

PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 17

SCOPe Domain Sequences for d2n26a_:

Sequence; same for both SEQRES and ATOM records:

>d2n26a_ g.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpygceecgksyrlisllnlhkkrhsgearyrcedcgklfttsgnlkrhqlvhsg

Timeline for d2n26a_:

• d2n26a_ is new in SCOPe 2.05-stable
  
• d2n26a_ appears in SCOPe 2.06
  
• d2n26a_ appears in the current release, SCOPe 2.08