Lineage for d2n26a_ (2n26 A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964751Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1964752Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1965117Family g.37.1.0: automated matches [196454] (1 protein)
    not a true family
  6. 1965118Protein automated matches [196455] (4 species)
    not a true protein
  7. 1965123Species Human (Homo sapiens) [TaxId:9606] [255137] (5 PDB entries)
  8. 1965125Domain d2n26a_: 2n26 A: [273892]
    automated match to d2kmka_
    complexed with zn

Details for d2n26a_

PDB Entry: 2n26 (more details)

PDB Description: solution structure of miz-1 zinc fingers 3 and 4
PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 17

SCOPe Domain Sequences for d2n26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n26a_ g.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpygceecgksyrlisllnlhkkrhsgearyrcedcgklfttsgnlkrhqlvhsg

SCOPe Domain Coordinates for d2n26a_:

Click to download the PDB-style file with coordinates for d2n26a_.
(The format of our PDB-style files is described here.)

Timeline for d2n26a_: