Lineage for d5bt8c1 (5bt8 C:1-395)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2142023Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. 2142024Protein automated matches [190573] (5 species)
    not a true protein
  7. 2142025Species Acinetobacter baumannii [TaxId:1116234] [273870] (1 PDB entry)
  8. 2142028Domain d5bt8c1: 5bt8 C:1-395 [273881]
    Other proteins in same PDB: d5bt8a2, d5bt8b2, d5bt8c2, d5bt8f2
    automated match to d3uwda_

Details for d5bt8c1

PDB Entry: 5bt8 (more details), 2.3 Å

PDB Description: x-ray crystal structure of phosphoglycerate kinase from acinetobacter baumannii
PDB Compounds: (C:) phosphoglycerate kinase

SCOPe Domain Sequences for d5bt8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bt8c1 c.86.1.0 (C:1-395) automated matches {Acinetobacter baumannii [TaxId: 1116234]}
mnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfshl
grpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpgekk
nnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgramqt
pekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadlve
takqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgpet
akafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaidky
nvadqigyistgggaflefvegktlpavavllera

SCOPe Domain Coordinates for d5bt8c1:

Click to download the PDB-style file with coordinates for d5bt8c1.
(The format of our PDB-style files is described here.)

Timeline for d5bt8c1:

  • d5bt8c1 first appeared in SCOPe 2.05, called d5bt8c_