Lineage for d5bs6b2 (5bs6 B:150-225)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694388Family a.4.5.68: Nudix-associated domain [140299] (2 proteins)
    PfamB PB002148; this domain is C-terminal to the Nudix domain in some bacterial proteins
  6. 2694389Protein Hypothetical protein BT0354, C-terminal domain [140300] (1 species)
  7. 2694390Species Bacteroides thetaiotaomicron [TaxId:818] [140301] (3 PDB entries)
    Uniprot Q8AAV8 150-225
  8. 2694394Domain d5bs6b2: 5bs6 B:150-225 [273879]
    Other proteins in same PDB: d5bs6a1, d5bs6b1, d5bs6b3, d5bs6c1, d5bs6c3, d5bs6d1, d5bs6d3
    automated match to d2fb1a1
    complexed with edo

Details for d5bs6b2

PDB Entry: 5bs6 (more details), 2.35 Å

PDB Description: apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
PDB Compounds: (B:) transcriptional regulator AraR

SCOPe Domain Sequences for d5bs6b2:

Sequence, based on SEQRES records: (download)

>d5bs6b2 a.4.5.68 (B:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal
ykfngkayrkdpkfkl

Sequence, based on observed residues (ATOM records): (download)

>d5bs6b2 a.4.5.68 (B:150-225) Hypothetical protein BT0354, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal
ykfngkayrkdpfkl

SCOPe Domain Coordinates for d5bs6b2:

Click to download the PDB-style file with coordinates for d5bs6b2.
(The format of our PDB-style files is described here.)

Timeline for d5bs6b2: