Lineage for d5bs6d1 (5bs6 D:1-149)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211779Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins)
    accosiated with the C-terminal "winged helix" domain (46785)
  6. 2211780Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species)
  7. 2211781Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (3 PDB entries)
    Uniprot Q8AAV8 3-149
  8. 2211787Domain d5bs6d1: 5bs6 D:1-149 [273873]
    Other proteins in same PDB: d5bs6a2, d5bs6b2, d5bs6b3, d5bs6c2, d5bs6c3, d5bs6d2, d5bs6d3
    automated match to d2fb1a2
    complexed with edo

Details for d5bs6d1

PDB Entry: 5bs6 (more details), 2.35 Å

PDB Description: apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi
PDB Compounds: (D:) transcriptional regulator AraR

SCOPe Domain Sequences for d5bs6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bs6d1 d.113.1.6 (D:1-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaa
krvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvn
inelpalifdhpemvdkaremmkqkasve

SCOPe Domain Coordinates for d5bs6d1:

Click to download the PDB-style file with coordinates for d5bs6d1.
(The format of our PDB-style files is described here.)

Timeline for d5bs6d1: