Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins) accosiated with the C-terminal "winged helix" domain (46785) |
Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (3 PDB entries) Uniprot Q8AAV8 3-149 |
Domain d5bs6d1: 5bs6 D:1-149 [273873] Other proteins in same PDB: d5bs6a2, d5bs6b2, d5bs6b3, d5bs6c2, d5bs6c3, d5bs6d2, d5bs6d3 automated match to d2fb1a2 complexed with edo |
PDB Entry: 5bs6 (more details), 2.35 Å
SCOPe Domain Sequences for d5bs6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bs6d1 d.113.1.6 (D:1-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaa krvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvn inelpalifdhpemvdkaremmkqkasve
Timeline for d5bs6d1: