SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5bt8b1 (5bt8 B:1-395)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2142023Family c.86.1.0: automated matches [191414] (1 protein)
    not a true family
  6. 2142024Protein automated matches [190573] (5 species)
    not a true protein
  7. 2142025Species Acinetobacter baumannii [TaxId:1116234] [273870] (1 PDB entry)
  8. 2142027Domain d5bt8b1: 5bt8 B:1-395 [273872]
    Other proteins in same PDB: d5bt8a2, d5bt8b2, d5bt8c2, d5bt8f2
    automated match to d3uwda_

Details for d5bt8b1

PDB Entry: 5bt8 (more details), 2.3 Å

PDB Description: x-ray crystal structure of phosphoglycerate kinase from acinetobacter baumannii
PDB Compounds: (B:) phosphoglycerate kinase

SCOPe Domain Sequences for d5bt8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bt8b1 c.86.1.0 (B:1-395) automated matches {Acinetobacter baumannii [TaxId: 1116234]}
mnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfshl
grpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpgekk
nnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgramqt
pekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadlve
takqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgpet
akafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaidky
nvadqigyistgggaflefvegktlpavavllera

SCOPe Domain Coordinates for d5bt8b1:

Click to download the PDB-style file with coordinates for d5bt8b1.
(The format of our PDB-style files is described here.)

Timeline for d5bt8b1:

  • d5bt8b1 first appeared in SCOPe 2.05, called d5bt8b_