SCOPe 2.04: Domain d2rtnb_: 2rtn B:

Lineage for d2rtnb_ (2rtn B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)

8. Domain d2rtnb_: 2rtn B: [27387]
   complexed with imi

Details for d2rtnb_

PDB Entry: 2rtn, 1.8 Å

PDB Description: streptavidin-2-iminobiotin complex, ph 2.0, space group i222

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d2rtnb_:

Sequence; same for both SEQRES and ATOM records:

>d2rtnb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtnb_:

• d2rtnb_ first appeared (with stable ids) in SCOP 1.55
  
• d2rtnb_ appears in SCOPe 2.03
  
• d2rtnb_ appears in SCOPe 2.05
  
• d2rtnb_ appears in the current release, SCOPe 2.08