| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) ![]() contains extra C-terminal strand automatically mapped to Pfam PF04729 |
| Family b.1.22.1: ASF1-like [101547] (2 proteins) |
| Protein automated matches [195145] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [273850] (3 PDB entries) |
| Domain d5bo0d_: 5bo0 D: [273853] Other proteins in same PDB: d5bo0a_, d5bo0b_ automated match to d1teya1 protein/DNA complex; complexed with gol |
PDB Entry: 5bo0 (more details), 2.91 Å
SCOPe Domain Sequences for d5bo0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bo0d_ b.1.22.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makvsvlnvavlenpspfhspfrfeisfecsealaddlewkiiyvgsaeseefdqildsv
lvgpvpagrhmfvfqadapnpslipetdavgvtvvlitctyhgqefirvgyyvnneylnp
elrenppmkpdfsqlqrnilasnprvtrfhinwd
Timeline for d5bo0d_: