Lineage for d5bo0d_ (5bo0 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766651Superfamily b.1.22: ASF1-like [101546] (2 families) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 2766652Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 2766678Protein automated matches [195145] (3 species)
    not a true protein
  7. 2766693Species Human (Homo sapiens) [TaxId:9606] [273850] (3 PDB entries)
  8. 2766695Domain d5bo0d_: 5bo0 D: [273853]
    Other proteins in same PDB: d5bo0a_, d5bo0b_
    automated match to d1teya1
    protein/DNA complex; complexed with gol

Details for d5bo0d_

PDB Entry: 5bo0 (more details), 2.91 Å

PDB Description: crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
PDB Compounds: (D:) Histone chaperone ASF1B

SCOPe Domain Sequences for d5bo0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bo0d_ b.1.22.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makvsvlnvavlenpspfhspfrfeisfecsealaddlewkiiyvgsaeseefdqildsv
lvgpvpagrhmfvfqadapnpslipetdavgvtvvlitctyhgqefirvgyyvnneylnp
elrenppmkpdfsqlqrnilasnprvtrfhinwd

SCOPe Domain Coordinates for d5bo0d_:

Click to download the PDB-style file with coordinates for d5bo0d_.
(The format of our PDB-style files is described here.)

Timeline for d5bo0d_: