Lineage for d1swdc_ (1swd C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 378913Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 378914Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 378937Protein Streptavidin [50878] (1 species)
  7. 378938Species Streptomyces avidinii [TaxId:1895] [50879] (113 PDB entries)
  8. 379167Domain d1swdc_: 1swd C: [27385]

Details for d1swdc_

PDB Entry: 1swd (more details), 1.9 Å

PDB Description: apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5

SCOP Domain Sequences for d1swdc_:

Sequence, based on SEQRES records: (download)

>d1swdc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swdc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesnaesryvltgrydsapatdgsgtalgwtva
wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOP Domain Coordinates for d1swdc_:

Click to download the PDB-style file with coordinates for d1swdc_.
(The format of our PDB-style files is described here.)

Timeline for d1swdc_: