| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries) |
| Domain d5bnvd_: 5bnv D: [273847] Other proteins in same PDB: d5bnvb_, d5bnve_ automated match to d2io5b_ protein/DNA complex; complexed with po4 |
PDB Entry: 5bnv (more details), 2.8 Å
SCOPe Domain Sequences for d5bnvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnvd_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakrv
timpkdiqlarrirgera
Timeline for d5bnvd_: