SCOPe 2.06: Domain d5bnvb_: 5bnv B:

Lineage for d5bnvb_ (5bnv B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [192456] (15 PDB entries)

8. Domain d5bnvb_: 5bnv B: [273844]
   Other proteins in same PDB: d5bnva_, d5bnvd_
   automated match to d1s32f_
   protein/DNA complex; complexed with po4

Details for d5bnvb_

PDB Entry: 5bnv, 2.8 Å

PDB Description: crystal structure of human mcm2 hbd chaperoning a histone h3-h4 tetramer

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5bnvb_:

Sequence; same for both SEQRES and ATOM records:

>d5bnvb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtl

Timeline for d5bnvb_:

• d5bnvb_ first appeared in SCOPe 2.05
  
• d5bnvb_ appears in SCOPe 2.07
  
• d5bnvb_ appears in the current release, SCOPe 2.08