Lineage for d1swdb_ (1swd B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674385Domain d1swdb_: 1swd B: [27384]

Details for d1swdb_

PDB Entry: 1swd (more details), 1.9 Å

PDB Description: apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5
PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1swdb_:

Sequence, based on SEQRES records: (download)

>d1swdb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swdb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyenaesryvltgrydsapatdgsgtalgwtvaw
knnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOP Domain Coordinates for d1swdb_:

Click to download the PDB-style file with coordinates for d1swdb_.
(The format of our PDB-style files is described here.)

Timeline for d1swdb_: