SCOPe 2.05: Domain d4ye3b_: 4ye3 B:

Lineage for d4ye3b_ (4ye3 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d4ye3b_: 4ye3 B: [273833]
   automated match to d4j55a_
   complexed with cl, g04, gol, y1

Details for d4ye3b_

PDB Entry: 4ye3, 1.35 Å

PDB Description: crystal structure of multidrug resistant hiv-1 protease clinical isolate pr20 with inhibitor grl-4410a

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4ye3b_:

Sequence; same for both SEQRES and ATOM records:

>d4ye3b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrpfvtvkvggqlkealldtgadntifedinlpgrwkpkmvggiggflkvreyd
qvpieicghkvigtvlvgptpvnvigrdtmtqigctlnf

Timeline for d4ye3b_:

• d4ye3b_ is new in SCOPe 2.05-stable
  
• d4ye3b_ appears in SCOPe 2.06
  
• d4ye3b_ appears in the current release, SCOPe 2.08