Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries) |
Domain d4ycub2: 4ycu B:222-575 [273831] Other proteins in same PDB: d4ycua1, d4ycub1 automated match to d3bjua2 protein/RNA complex; complexed with gol, krs, lys |
PDB Entry: 4ycu (more details), 2.1 Å
SCOPe Domain Sequences for d4ycub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ycub2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]} dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp
Timeline for d4ycub2: