Lineage for d4ycub2 (4ycu B:222-575)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208934Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2208935Protein automated matches [226887] (13 species)
    not a true protein
  7. 2208972Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)
  8. 2208982Domain d4ycub2: 4ycu B:222-575 [273831]
    Other proteins in same PDB: d4ycua1, d4ycub1
    automated match to d3bjua2
    protein/RNA complex; complexed with gol, krs, lys

Details for d4ycub2

PDB Entry: 4ycu (more details), 2.1 Å

PDB Description: crystal structure of cladosporin in complex with human lysyl-trna synthetase
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ycub2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d4ycub2:

Click to download the PDB-style file with coordinates for d4ycub2.
(The format of our PDB-style files is described here.)

Timeline for d4ycub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ycub1