SCOPe 2.06: Domain d1swda_: 1swd A:

Lineage for d1swda_ (1swd A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)

8. Domain d1swda_: 1swd A: [27383]
   complexed with btn

Details for d1swda_

PDB Entry: 1swd, 1.9 Å

PDB Description: apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1swda_:

Sequence; same for both SEQRES and ATOM records:

>d1swda_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk

Timeline for d1swda_:

• d1swda_ first appeared (with stable ids) in SCOP 1.55
  
• d1swda_ appears in SCOPe 2.05
  
• d1swda_ appears in SCOPe 2.07
  
• d1swda_ appears in the current release, SCOPe 2.08