SCOPe 2.05: Domain d4ycua1: 4ycu A:72-221

Lineage for d4ycua1 (4ycu A:72-221)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (8 PDB entries)

8. Domain d4ycua1: 4ycu A:72-221 [273828]
   Other proteins in same PDB: d4ycua2, d4ycub2
   automated match to d3bjua1
   protein/RNA complex; complexed with gol, krs, lys

Details for d4ycua1

PDB Entry: 4ycu, 2.1 Å

PDB Description: crystal structure of cladosporin in complex with human lysyl-trna synthetase

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycua1:

Sequence; same for both SEQRES and ATOM records:

>d4ycua1 b.40.4.0 (A:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphlhfglk

Timeline for d4ycua1:

• d4ycua1 is new in SCOPe 2.05-stable
  
• d4ycua1 appears in SCOPe 2.06
  
• d4ycua1 appears in the current release, SCOPe 2.08