Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (8 PDB entries) |
Domain d4ycua1: 4ycu A:72-221 [273828] Other proteins in same PDB: d4ycua2, d4ycub2 automated match to d3bjua1 protein/RNA complex; complexed with gol, krs, lys |
PDB Entry: 4ycu (more details), 2.1 Å
SCOPe Domain Sequences for d4ycua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ycua1 b.40.4.0 (A:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt kkgelsiipyeitllspclhmlphlhfglk
Timeline for d4ycua1: