Lineage for d4ycwe2 (4ycw E:222-575)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968077Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2968116Domain d4ycwe2: 4ycw E:222-575 [273827]
    Other proteins in same PDB: d4ycwa1, d4ycwb1, d4ycwe1, d4ycwf1
    automated match to d3bjua2
    protein/RNA complex; complexed with krs, lys; mutant

Details for d4ycwe2

PDB Entry: 4ycw (more details), 2.9 Å

PDB Description: crystal structure of cladosporin in complex with plasmodium like human lysyl-trna synthetase mutant
PDB Compounds: (E:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ycwe2 d.104.1.0 (E:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriatelyhkmlvvggidrvyeigrvfrnegidlthnpeftscefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d4ycwe2:

Click to download the PDB-style file with coordinates for d4ycwe2.
(The format of our PDB-style files is described here.)

Timeline for d4ycwe2: