Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
Domain d4ycwe1: 4ycw E:72-216 [273826] Other proteins in same PDB: d4ycwa2, d4ycwb2, d4ycwe2, d4ycwf2 automated match to d3bjua1 protein/RNA complex; complexed with krs, lys; mutant |
PDB Entry: 4ycw (more details), 2.9 Å
SCOPe Domain Sequences for d4ycwe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ycwe1 b.40.4.0 (E:72-216) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt kkgelsiipyeitllspclhmlphl
Timeline for d4ycwe1: