Lineage for d4ycwb2 (4ycw B:222-575)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574631Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2574632Protein automated matches [226887] (24 species)
    not a true protein
  7. 2574692Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2574730Domain d4ycwb2: 4ycw B:222-575 [273825]
    Other proteins in same PDB: d4ycwa1, d4ycwb1, d4ycwe1, d4ycwf1
    automated match to d3bjua2
    protein/RNA complex; complexed with krs, lys; mutant

Details for d4ycwb2

PDB Entry: 4ycw (more details), 2.9 Å

PDB Description: crystal structure of cladosporin in complex with plasmodium like human lysyl-trna synthetase mutant
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ycwb2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriatelyhkmlvvggidrvyeigrvfrnegidlthnpeftscefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

SCOPe Domain Coordinates for d4ycwb2:

Click to download the PDB-style file with coordinates for d4ycwb2.
(The format of our PDB-style files is described here.)

Timeline for d4ycwb2: