SCOPe 2.05: Domain d4ycwb2: 4ycw B:222-575

Lineage for d4ycwb2 (4ycw B:222-575)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)

8. Domain d4ycwb2: 4ycw B:222-575 [273825]
   Other proteins in same PDB: d4ycwa1, d4ycwb1, d4ycwe1, d4ycwf1
   automated match to d3bjua2
   protein/RNA complex; complexed with krs, lys; mutant

Details for d4ycwb2

PDB Entry: 4ycw, 2.9 Å

PDB Description: crystal structure of cladosporin in complex with plasmodium like human lysyl-trna synthetase mutant

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycwb2:

Sequence; same for both SEQRES and ATOM records:

>d4ycwb2 d.104.1.0 (B:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriatelyhkmlvvggidrvyeigrvfrnegidlthnpeftscefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

Timeline for d4ycwb2:

• d4ycwb2 is new in SCOPe 2.05-stable
  
• d4ycwb2 appears in SCOPe 2.06
  
• d4ycwb2 appears in the current release, SCOPe 2.08