Lineage for d4ycwa1 (4ycw A:72-221)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400092Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)
  8. 2400124Domain d4ycwa1: 4ycw A:72-221 [273822]
    Other proteins in same PDB: d4ycwa2, d4ycwb2, d4ycwe2, d4ycwf2
    automated match to d3bjua1
    protein/RNA complex; complexed with krs, lys; mutant

Details for d4ycwa1

PDB Entry: 4ycw (more details), 2.9 Å

PDB Description: crystal structure of cladosporin in complex with plasmodium like human lysyl-trna synthetase mutant
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycwa1:

Sequence, based on SEQRES records: (download)

>d4ycwa1 b.40.4.0 (A:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records): (download)

>d4ycwa1 b.40.4.0 (A:72-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphllk

SCOPe Domain Coordinates for d4ycwa1:

Click to download the PDB-style file with coordinates for d4ycwa1.
(The format of our PDB-style files is described here.)

Timeline for d4ycwa1: