| Root: SCOPe 2.07 |
| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
| Protein automated matches [190576] (50 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries) |
| Domain d4ycwf1: 4ycw F:72-216 [273820] Other proteins in same PDB: d4ycwa2, d4ycwb2, d4ycwe2, d4ycwf2 automated match to d3bjua1 protein/RNA complex; complexed with krs, lys; mutant |
PDB Entry: 4ycw (more details), 2.9 Å
SCOPe Domain Sequences for d4ycwf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ycwf1 b.40.4.0 (F:72-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphl
Timeline for d4ycwf1: